Floral dip: a simplified methodology for Agrobacterium-mediated transformation of Arabidopsis thalian.
The Agrobacterium vacuum infiltration methodology has made it doable to rework Arabidopsis thaliana with out plant tissue tradition or regeneration. Within the current research, this methodology was evaluated and a considerably modified transformation methodology was developed.
The labor-intensive vacuum infiltration course of was eradicated in favor of easy dipping of creating floral tissues right into a answer containing Agrobacterium tumefaciens, 5% sucrose and 500 microliters per litre of surfactant Silwet L-77.
Sucrose and surfactant had been vital to the success of the floral dip methodology. Vegetation inoculated when quite a few immature floral buds and few siliques had been current produced reworked progeny on the highest charge. Plant tissue tradition media, the hormone benzylamino purine and pH adjustment had been pointless, and Agrobacterium might be utilized to crops at a variety of celldensities.
Repeated software of Agrobacterium improved transformation charges and total yield of transformants roughly twofold. Overlaying crops for 1 day to retain humidity after inoculation additionally raised transformation charges twofold.
A number of ecotypes had been transformable by this methodology. The modified methodology ought to facilitate high-throughput transformation of Arabidopsis for efforts corresponding to T-DNA gene tagging, positional cloning, or makes an attempt at focused gene alternative.
Description: A polyclonal antibody raised in Chicken that recognizes and binds to Human Beta-Amyloid Peptide (N-terminus). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody for detection of Amyloid-Beta from Human, Mouse, Rat. This Amyloid-Beta antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Amyloid-? around the non-phosphorylation site of T743
Description: A polyclonal antibody for detection of Amyloid-Beta from Human, Mouse, Rat. This Amyloid-Beta antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Amyloid-? around the non-phosphorylation site of T743
Description: A polyclonal antibody for detection of Amyloid-Beta from Human, Mouse, Rat. This Amyloid-Beta antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Amyloid-? around the non-phosphorylation site of T743
Description: A polyclonal antibody for detection of Amyloid-Beta from Human, Mouse, Rat. This Amyloid-Beta antibody is for WB, IF, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from Amyloid-? at AA range: 221-270
Description: A polyclonal antibody for detection of Amyloid-Beta from Human, Mouse, Rat. This Amyloid-Beta antibody is for WB, IF, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from Amyloid-? at AA range: 221-270
Description: A polyclonal antibody for detection of Amyloid-Beta from Human, Mouse, Rat. This Amyloid-Beta antibody is for WB, IF, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from Amyloid-? at AA range: 221-270
Description: A polyclonal antibody for detection of Amyloid-Beta from Human. This Amyloid-Beta antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from Amyloid-? at AA range: 631-680
Description: A polyclonal antibody for detection of Amyloid-Beta from Human. This Amyloid-Beta antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from Amyloid-? at AA range: 631-680
Description: A polyclonal antibody for detection of Amyloid-Beta from Human. This Amyloid-Beta antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from Amyloid-? at AA range: 631-680
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human APCS / Serum Amyloid P / SAP (aa1-223). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody for detection of Amyloid-Beta phospho Thr743) from Human, Mouse, Rat. This Amyloid-Beta phospho Thr743) antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Amyloid-? around the phosphorylation site of T743
Description: A polyclonal antibody for detection of Amyloid-Beta phospho Thr743) from Human, Mouse, Rat. This Amyloid-Beta phospho Thr743) antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Amyloid-? around the phosphorylation site of T743
Description: A polyclonal antibody for detection of Amyloid-Beta phospho Thr743) from Human, Mouse, Rat. This Amyloid-Beta phospho Thr743) antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Amyloid-? around the phosphorylation site of T743
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human APP / Beta Amyloid (Thr668). This antibody is tested and proven to work in the following applications:
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human ACKR1 (aa1-50). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human GRASP (aa1-20). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human PIN1 (aa1-50). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human SOX9 (aa1-150). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human DECR1 (aa1-335). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human VCP (aa1-206). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human ID4 (aa1-50). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human ACTN3 (aa1-50). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human ARHGEF11 (aa1-50). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human EPS8L2 (aa1-50). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human FHL5 (aa1-226). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human GSTA2 (aa1-196). This antibody is tested and proven to work in the following applications:
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human HAPLN3 (aa1-50). This antibody is tested and proven to work in the following applications:
×
Correct transcription initiation by RNA polymerase II in a soluble extract from remoted mammalian nuclei.
We’ve developed a process for getting ready extracts from nuclei of human tissue traditioncells that directs correct transcription initiation in vitro from class II promoters.
Circumstances of extraction and assay have been optimized for optimum exercise utilizing the main late promoter of adenovirus 2. The extract additionally directs correct transcription initiation from different adenovirus promoters and mobile promoters.
The extract additionally directs correct transcription initiation from class III promoters (tRNA and Advert 2 VA).
Recombinant genomes which specific chloramphenicol acetyltransferase in mammalian cells.
We constructed a sequence of recombinant genomes which directed expression of the enzyme chloramphenicol acetyltransferase (CAT) in mammaliancells.
The prototype recombinant on this sequence, pSV2-cat, consisted of the beta-lactamase gene and origin of replication from pBR322 coupled to a simian virus 40 (SV40) early transcription area into which CAT coding sequences had been inserted.
Readily measured ranges of CAT amassed inside 48 h after the introduction of pSV2-cat DNA into African inexperienced monkey kidney CV-1 cells. As a result of endogenous CAT exercise will not be current in CV-1 or different mammaliancells, and since speedy, delicate assays for CAT exercise can be found, these recombinants supplied a uniquely handy system for monitoring the expression of international DNAs in tissue traditioncells.
To display the usefulness of this technique, we constructed derivatives of pSV2-cat from which half or all the SV40 promoter area was eliminated.
Deletion of 1 copy of the 72-base-pair repeat sequence within the SV40 promoter triggered no important lower in CAT synthesis in monkey kidney CV-1 cells; nonetheless, an extra deletion of 50 base pairs from the second copy of the repeats decreased CAT synthesis to 11% of its stage within the wild kind.
We additionally constructed a recombinant, pSV0-cat, through which the complete SV40 promoter area was eliminated and a singular HindIII web site was substituted for the insertion of different promoter sequences.
Description: A sandwich quantitative ELISA assay kit for detection of Human Arachidonate-5-Lipoxygenase (ALOX5) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Human Arachidonate-5-Lipoxygenase (ALOX5) ELISA Kit
Description: A sandwich quantitative ELISA assay kit for detection of Human Arachidonate-5-Lipoxygenase (ALOX5) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Arachidonate-5-Lipoxygenase (ALOX5) in samples from tissue homogenates, cell lysates or other biological fluids.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Arachidonate-5-Lipoxygenase (ALOX5) in samples from tissue homogenates, cell lysates or other biological fluids.
Description: A sandwich quantitative ELISA assay kit for detection of Rat Arachidonate-5-Lipoxygenase (ALOX5) in samples from tissue homogenates, cell lysates or other biological fluids.
Description: A sandwich quantitative ELISA assay kit for detection of Rat Arachidonate-5-Lipoxygenase (ALOX5) in samples from tissue homogenates, cell lysates or other biological fluids.
Human Arachidonate-5-Lipoxygenase (ALOX5) ELISA Kit
Description: A polyclonal antibody against ALOX5. Recognizes ALOX5 from Human, Mouse. This antibody is Unconjugated. Tested in the following application: ELISA, IF
Description: A polyclonal antibody against ALOX5. Recognizes ALOX5 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, IHC; Recommended dilution: IHC:1:20-1:200
Description: A polyclonal antibody against ALOX5. Recognizes ALOX5 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: WB, IHC, ELISA;WB:1/500-1/2000.IHC:1/100-1/300.ELISA:1/10000
Description: A polyclonal antibody against ALOX5. Recognizes ALOX5 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;ELISA:1:500-1:5000, IHC:1:50-1:150
Description: A polyclonal antibody against ALOX5. Recognizes ALOX5 from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;ELISA:1:500-1:2000, IHC:1:25-1:100
Description: This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Description: A polyclonal antibody against ALOX5. Recognizes ALOX5 from Human. This antibody is HRP conjugated. Tested in the following application: ELISA
Description: A polyclonal antibody against ALOX5. Recognizes ALOX5 from Human. This antibody is FITC conjugated. Tested in the following application: ELISA
Description: A polyclonal antibody against ALOX5. Recognizes ALOX5 from Human. This antibody is Biotin conjugated. Tested in the following application: ELISA
Description: A polyclonal antibody against Phospho-ALOX5 (S523). Recognizes Phospho-ALOX5 (S523) from Human, Rat. This antibody is Unconjugated. Tested in the following application: WB, ELISA;WB:1/500-1/2000.ELISA:1/10000
Description: A polyclonal antibody against Phospho-ALOX5 (S272). Recognizes Phospho-ALOX5 (S272) from Human, Mouse, Rat. This antibody is Unconjugated. Tested in the following application: WB, IHC, ELISA;WB:1/500-1/2000.IHC:1/100-1/300.ELISA:1/10000
Description: A polyclonal antibody against Phospho-ALOX5 (Ser523). Recognizes Phospho-ALOX5 (Ser523) from Human, Rat. This antibody is Unconjugated. Tested in the following application: ELISA, WB;WB:1:500-1:3000
Description: A polyclonal antibody against Phospho-ALOX5 (Ser523). Recognizes Phospho-ALOX5 (Ser523) from Human, Rat. This antibody is Unconjugated. Tested in the following application: ELISA, WB;WB:1:500-1:3000
Description: This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.